Protein coding transcript 38477

• Transcript: Ll_transcript_500219
• CDS coordinates: 184-603 (+)
• Peptide sequence: MSDSVPVSITASDLGISGIYLVHDFISAEEEEVLLQAVDCRPWNCLSKRRVQHYGYEFCYDTRNVNTRHCLGELPSFVSPLLERISSCPTFKNVENIVLDQVTVNEYPSGVGLSPHIDTHSAFEDLIFSLSLSGPCIMEF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_500219

• Blastp: Alkylated DNA repair protein alkB homolog 8 from Silurana with 41.22% of identity
• Blastx: Alkylated DNA repair protein alkB homolog 8 from Silurana with 41.41% of identity
• Eggnog: Methyltransferase(COG0500)
• Kegg: Link to kegg annotations (550051)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445183.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF13532.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;