Transcript | Ll_transcript_500219 |
---|---|
CDS coordinates | 184-603 (+) |
Peptide sequence | MSDSVPVSITASDLGISGIYLVHDFISAEEEEVLLQAVDCRPWNCLSKRRVQHYGYEFCYDTRNVNTRHCLGELPSFVSPLLERISSCPTFKNVENIVLDQVTVNEYPSGVGLSPHIDTHSAFEDLIFSLSLSGPCIMEF |
ORF Type | 3prime_partial |
Blastp | Alkylated DNA repair protein alkB homolog 8 from Silurana with 41.22% of identity |
---|---|
Blastx | Alkylated DNA repair protein alkB homolog 8 from Silurana with 41.41% of identity |
Eggnog | Methyltransferase(COG0500) |
Kegg | Link to kegg annotations (550051) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445183.1) |
Pfam | 2OG-Fe(II) oxygenase superfamily (PF13532.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer