Protein coding transcript 38499

• Transcript: Ll_transcript_502287
• CDS coordinates: 114-533 (+)
• Peptide sequence: MLNSRVARFGACVAKHLSKRTYASMSRSPYILTATNRCLQPPLSFNMLYNGAMIKKHSFFSTMTTNNTSEEGGDKEETISVTFVGKDDGETHIKVPVGMSMLEAAHENDIELEGACEASLACSTCHVIVMSNYLTLYRM*
• ORF Type: complete

Annotations of Ll_transcript_502287

• Blastp: Adrenodoxin-like protein 2, mitochondrial from Arabidopsis with 49.26% of identity
• Blastx: Adrenodoxin-like protein 2, mitochondrial from Arabidopsis with 47.37% of identity
• Eggnog: Ferredoxin(COG0633)
• Kegg: Link to kegg annotations (AT4G21090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443557.1)
• Pfam: 2Fe-2S iron-sulfur cluster binding domain (PF00111.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;