Transcript | Ll_transcript_502302 |
---|---|
CDS coordinates | 2583-3230 (+) |
Peptide sequence | MASFTVSNHSLPSFRMLNTQTLNYPSSQILPTPSNSHFFGLKLSNSSTFSIPSTPVSFSQKPSIFAKVSKGSKPPPFTLKDQDGKTVSLTNFKGKPVVVYFYPADDSPSCTKQACAFRDSYEKFKKAGAEVIGISGDGSSSHKAFAKKHRLPFTLLSDEGDKVRKEWGVPSDLFGALPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQSL* |
ORF Type | complete |
Blastp | Peroxiredoxin Q, chloroplastic from Sedum with 80.85% of identity |
---|---|
Blastx | Peroxiredoxin Q, chloroplastic from Sedum with 80.85% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443533.1) |
Pfam | Redoxin (PF08534.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer