Transcript | Ll_transcript_502298 |
---|---|
CDS coordinates | 114-539 (+) |
Peptide sequence | MLNSRVARFGACVAKHLSKRTYASMSRSPYILTATNRCLQPPLSFNMLYNGAMIKKHSFFSTMTTNNTSEEGGDKEETISVTFVGKDDGETHIKVPVGMSMLEAAHENDIELEGACEASLACSTCHVIVMVCHGMCYIKLA* |
ORF Type | complete |
Blastp | Adrenodoxin-like protein 2, mitochondrial from Arabidopsis with 49.63% of identity |
---|---|
Blastx | Adrenodoxin-like protein 2, mitochondrial from Arabidopsis with 47.73% of identity |
Eggnog | Ferredoxin(COG0633) |
Kegg | Link to kegg annotations (AT4G21090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443557.1) |
Pfam | 2Fe-2S iron-sulfur cluster binding domain (PF00111.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer