Protein coding transcript 38576

• Transcript: Ll_transcript_501138
• CDS coordinates: 383-1141 (+)
• Peptide sequence: MTDRVYPAAKPAVNGGAANASFPATKAQLYGASRPTYRPQPYHHRRSRRRICCTICFWLILIILILLLIIGVAGAVVYLLYRPHSPSFTVTALKLSHFNLTSSTLNSKFDVNVTATNPNKKITFSYDPTTVSIFSGDVDVGDGTVAGFFHREKNITLLKASILRSGVALESADEAKLKSSMKSKSGLALTVKLETKVKGNMGKLKTPKVRIRVVCDGIRVTIPVGKKPVVGSTSNAKCDVNVRFKIWKWTVG*
• ORF Type: complete

Annotations of Ll_transcript_501138

• Blastp: NDR1/HIN1-like protein 13 from Arabidopsis with 28.57% of identity
• Blastx: NDR1/HIN1-like protein 3 from Arabidopsis with 24.71% of identity
• Eggnog: Harpin-induced protein 1 containing protein, expressed(ENOG410YIDD)
• Kegg: Link to kegg annotations (AT2G27080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448222.1)
• Pfam: Late embryogenesis abundant protein (PF03168.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;