Protein coding transcript 387

• Transcript: Ll_transcript_481940
• CDS coordinates: 1-459 (+)
• Peptide sequence: DRCGYKDDRKSTTCFLFKLGDASISWSSQEQKVVALSSCEAEYIVAFLGGCQGLWLNSLLKELKIYANDSMLLLIDNQSAINLARNPVSHSRNKHIETKYHFLRDHVEKGNLKVEFCTSQNQQADVLTKSLRKEAFELQRRKLGVVSITSLN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_481940

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 40.82% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 40.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014625999.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;