Protein coding transcript 38765

• Transcript: Ll_transcript_501598
• CDS coordinates: 2-355 (+)
• Peptide sequence: LLYAHARICSIIRKSGKDIEQVKKTGKIVLDHDGERALGLHLVQFSEVVEQACTNLLPSTLCEYLYDLSDIFTKKFYSNCQVIGSPEETSRLLLCEATAIVMRKCFYLLGIEPVYKI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_501598

• Blastp: Arginine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 82.05% of identity
• Blastx: Arginine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 82.05% of identity
• Eggnog: arginyL-tRNA synthetase(COG0018)
• Kegg: Link to kegg annotations (AT4G26300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458197.1)
• Pfam: DALR anticodon binding domain (PF05746.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;