Protein coding transcript 38808

• Transcript: Ll_transcript_500968
• CDS coordinates: 179-607 (+)
• Peptide sequence: MSRTWIIYNKPEEANSVHAGLLFALGLHGYLRVLVITDIYQYLNQGHETTTVGLMLGLAASYRGTMQPAISKCLYIHIPGRHPSSFPEIEVPTLVQSAALMSVGILYEGSAHPQTMHVLLVYFSCLSLIFIPCLSIYKLLSL*
• ORF Type: complete

Annotations of Ll_transcript_500968

• Blastp: Anaphase-promoting complex subunit 1 from Arabidopsis with 70% of identity
• Blastx: Anaphase-promoting complex subunit 1 from Arabidopsis with 69.29% of identity
• Eggnog: Anaphase promoting complex subunit 1(ENOG410XQ83)
• Kegg: Link to kegg annotations (AT5G05560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433711.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;