Protein coding transcript 38844

• Transcript: Ll_transcript_500608
• CDS coordinates: 433-1248 (+)
• Peptide sequence: MTTLQSSLQKQAFLLHKLMYLWAGGCAMLLTNKRSLKHKAILRLKCLVRIHHGAIEDAYNCCNQKEDDQGKLGFYLSKNLPKAATKAFVDNLRVLSPRVLPTREFLRYMIMSLIKKLNRNSSTKIATPNKSPLDFKSGVEHFFLFLGGKAVIDGIGMSLDLCEYDLEPARMTLHRFGNTSASSLWYVLGYMEAKKKLKKGDRVLMISFGAGFKCNSCLWQVMKDVGGRNVWDDCIDCYPPKSLANPFMEKFGWINNVQDPSTFQFQDFLNK*
• ORF Type: complete

Annotations of Ll_transcript_500608

• Blastp: 3-ketoacyl-CoA synthase 12 from Arabidopsis with 63.28% of identity
• Blastx: 3-ketoacyl-CoA synthase 12 from Arabidopsis with 63.28% of identity
• Eggnog: 3-ketoacyl-coa synthase(ENOG410Y9JS)
• Kegg: Link to kegg annotations (AT2G28630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438788.1)
• Pfam: FAE1/Type III polyketide synthase-like protein (PF08392.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;