Transcript | Ll_transcript_500612 |
---|---|
CDS coordinates | 237-746 (+) |
Peptide sequence | MLGTDCCGKIMERNKNLGLNEYKFLLKAVVSSGVGEKTYAPRNIIQGREANPTLNDGIIEMEEFFNDNIAKLLAKTGISPSQIDVLVVNVSMISPHPSLASRIINHYKMRHDIKAFNLTGMGCSASLISLDIIKNIFISQKNKFALLVTSESLSPNWYSGNDRSMILANC |
ORF Type | 3prime_partial |
Blastp | 3-ketoacyl-CoA synthase 12 from Arabidopsis with 71.76% of identity |
---|---|
Blastx | 3-ketoacyl-CoA synthase 12 from Arabidopsis with 70.77% of identity |
Eggnog | 3-ketoacyl-coa synthase(ENOG410Y9JS) |
Kegg | Link to kegg annotations (AT2G28630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436233.1) |
Pfam | FAE1/Type III polyketide synthase-like protein (PF08392.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer