Protein coding transcript 38866

• Transcript: Ll_transcript_500475
• CDS coordinates: 677-1144 (+)
• Peptide sequence: MNVPPLGSLPGTKIIQSERNDSYLHELSSLATLHNKALSMILLQLEKQLKDFKYSLYDFNADVTQMMNQPLKYGLKEGKSACCGWGAFRGKYNCGGKRGDKRFELCEKPNEYLYWDSYHLTESAYKQIAFRMWNYRRSNSHTLGPYTIRNLFQAS*
• ORF Type: complete

Annotations of Ll_transcript_500475

• Blastp: GDSL esterase/lipase 5 from Arabidopsis with 48.05% of identity
• Blastx: GDSL esterase/lipase 5 from Arabidopsis with 48.21% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT1G53920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459089.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;