Transcript | Ll_transcript_500475 |
---|---|
CDS coordinates | 677-1144 (+) |
Peptide sequence | MNVPPLGSLPGTKIIQSERNDSYLHELSSLATLHNKALSMILLQLEKQLKDFKYSLYDFNADVTQMMNQPLKYGLKEGKSACCGWGAFRGKYNCGGKRGDKRFELCEKPNEYLYWDSYHLTESAYKQIAFRMWNYRRSNSHTLGPYTIRNLFQAS* |
ORF Type | complete |
Blastp | GDSL esterase/lipase 5 from Arabidopsis with 48.05% of identity |
---|---|
Blastx | GDSL esterase/lipase 5 from Arabidopsis with 48.21% of identity |
Eggnog | GDSL esterase lipase(COG3240) |
Kegg | Link to kegg annotations (AT1G53920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459089.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer