Transcript | Ll_transcript_500503 |
---|---|
CDS coordinates | 162-584 (+) |
Peptide sequence | MMFMNEPTLPEEVVQVLPSDPFEQLDVARKIMSVALATRVNALQSESSILSAELANKDATVAELQSEVDSLYAAISEAEDRFGQAEEEKERLVTENASLSNTVTKLTRDVSKLEAFKKTLMQSFREEEENSVRLLLLFLF* |
ORF Type | complete |
Blastp | Uncharacterized protein At4g15545 from Arabidopsis with 60.98% of identity |
---|---|
Blastx | Uncharacterized protein At4g15545 from Arabidopsis with 60.98% of identity |
Eggnog | NA(ENOG4111Y4K) |
Kegg | Link to kegg annotations (AT4G15545) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439739.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer