Protein coding transcript 38877

• Transcript: Ll_transcript_500505
• CDS coordinates: 197-703 (+)
• Peptide sequence: MQSLQEEEDNSGGAPDIVAKVQSQTSLSSTSQIGDDDASLPPSKPSSVRAYISDTENSFAEDHEYDAIRPRVPYNLLLASQTTTPRLTPPGSPPSLSTSASPTRTSKPVSPRRHSISFSTSRGMYDDRSSVFSSVPSSHGSISTSEIGTGSQGGRTRVDGKEFFRQVR*
• ORF Type: complete

Annotations of Ll_transcript_500505

• Blastp: Uncharacterized protein At4g15545 from Arabidopsis with 49.11% of identity
• Blastx: Uncharacterized protein At4g15545 from Arabidopsis with 48.28% of identity
• Eggnog: NA(ENOG4111Y4K)
• Kegg: Link to kegg annotations (AT4G15545)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437366.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;