| Transcript | Ll_transcript_500481 |
|---|---|
| CDS coordinates | 162-584 (+) |
| Peptide sequence | MMFMNEPTLPEEVVQVLPSDPFEQLDVARKIMSVALATRVNALQSESSILSAELANKDATVAELQSEVDSLYAAISEAEDRFGQAEEEKERLVTENASLSNTVTKLTRDVSKLEAFKKTLMQSFREEEENSVRLLLLFLF* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At4g15545 from Arabidopsis with 62.89% of identity |
|---|---|
| Blastx | Uncharacterized protein At4g15545 from Arabidopsis with 62.26% of identity |
| Eggnog | NA(ENOG4111Y4K) |
| Kegg | Link to kegg annotations (AT4G15545) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439737.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer