Protein coding transcript 38887

• Transcript: Ll_transcript_500483
• CDS coordinates: 538-1059 (+)
• Peptide sequence: MQAYVSETGNSFSEDQESDVAARARVPYNFLLASQTSTPRITPPGSPPSLSASVSPTRSSKPVSPIRRHSVSFSSSRGIYDDRSSVFSSTASVSSTDTLSQTGRTRVDGKEFFRQVRSRLSNEQFGAFLANVKELNSHKQTKEETLQKVDEIFGAENKHLYAIFEGLITRNVH*
• ORF Type: complete

Annotations of Ll_transcript_500483

• Blastp: Uncharacterized protein At4g15545 from Arabidopsis with 62.89% of identity
• Blastx: Uncharacterized protein At4g15545 from Arabidopsis with 62.26% of identity
• Eggnog: NA(ENOG4111Y4K)
• Kegg: Link to kegg annotations (AT4G15545)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439739.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;