Protein coding transcript 38912

• Transcript: Ll_transcript_499759
• CDS coordinates: 2748-3314 (+)
• Peptide sequence: MAADQRRKRLNGATIIGYGHREQNRNKRKNLGSAQNDLSMKSHIAIEWDANQKRVVSKPEQIGISWRHMKPFVNFVSEDHNVLADVFTIPEEIFDLDNLTEVLSYEVWKTHLSENEKSLLMHFLPSAFEPHQSVEELLSGNKFHFGNPFLKWGASLCLGDLHPDVIIDREQHLKSEKRAYYSQLHNYHK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_499759

• Blastp: Nuclear factor related to kappa-B-binding protein from Silurana with 33.03% of identity
• Blastx: Nuclear factor related to kappa-B-binding protein from Silurana with 33.03% of identity
• Eggnog: Nuclear factor related to kappaB binding protein(ENOG410YHF2)
• Kegg: Link to kegg annotations (394815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453084.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;