Transcript | Ll_transcript_499765 |
---|---|
CDS coordinates | 2854-3420 (+) |
Peptide sequence | MAADQRRKRLNGATIIGYGHREQNRNKRKNLGSAQNDLSMKSHIAIEWDANQKRVVSKPEQIGISWRHMKPFVNFVSEDHNVLADVFTIPEEIFDLDNLTEVLSYEVWKTHLSENEKSLLMHFLPSAFEPHQSVEELLSGNKFHFGNPFLKWGASLCLGDLHPDVIIDREQHLKSEKRAYYSQLHNYHK |
ORF Type | 3prime_partial |
Blastp | Nuclear factor related to kappa-B-binding protein from Silurana with 33.03% of identity |
---|---|
Blastx | Nuclear factor related to kappa-B-binding protein from Silurana with 33.03% of identity |
Eggnog | Nuclear factor related to kappaB binding protein(ENOG410YHF2) |
Kegg | Link to kegg annotations (394815) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453084.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer