| Transcript | Ll_transcript_501838 |
|---|---|
| CDS coordinates | 1346-1657 (+) |
| Peptide sequence | MYYRGAAAAIIVYDITNSDSFTRAKKWVQELQKQGNPNMVVALAGNKADLEDKRKVTAEEARAYAEENGLFFMETSAKTAANVNDVFHEIGVTPFLAYTLGDA* |
| ORF Type | complete |
| Blastp | Ras-related protein RHN1 from Nicotiana with 90% of identity |
|---|---|
| Blastx | Ras-related protein RHN1 from Nicotiana with 91.47% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460953.1) |
| Pfam | Ras family (PF00071.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer