Transcript | Ll_transcript_501848 |
---|---|
CDS coordinates | 1701-2084 (+) |
Peptide sequence | MLIIYYLCLLRFYMLASVFYSQDSFTRAKKWVQELQKQGNPNMVVALAGNKADLEDKRKVTAEEARAYAEENGLFFMETSAKTAANVNDVFHEIAKRLPRAQPAQKPAGMVLVDRPADGARAASCCS* |
ORF Type | complete |
Blastp | Ras-related protein RHN1 from Nicotiana with 73.85% of identity |
---|---|
Blastx | Ras-related protein RHN1 from Nicotiana with 73.85% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003553043.1) |
Pfam | Ras family (PF00071.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer