Protein coding transcript 38942

• Transcript: Ll_transcript_501831
• CDS coordinates: 1506-1889 (+)
• Peptide sequence: MLIIYYLCLLRFYMLASVFYSQDSFTRAKKWVQELQKQGNPNMVVALAGNKADLEDKRKVTAEEARAYAEENGLFFMETSAKTAANVNDVFHEIAKRLPRAQPAQKPAGMVLVDRPADGARAASCCS*
• ORF Type: complete

Annotations of Ll_transcript_501831

• Blastp: Ras-related protein RHN1 from Nicotiana with 73.85% of identity
• Blastx: Ras-related protein RHN1 from Nicotiana with 73.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003553043.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;