Transcript | Ll_transcript_501832 |
---|---|
CDS coordinates | 308-910 (+) |
Peptide sequence | MSTIANNNLNAKLVLLGDMGAGKSSLVLRFVKGQFLEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITSSDSFSRAKKWVQELQKQGNPNLVMALAGNKADLEDKRKVTAEEARVYAEENGLFFIETSAKTAANVNDIFYEIAKRLPRTQPAQNPAGMVLVDKTAEGSRTASCCS* |
ORF Type | complete |
Blastp | Ras-related protein RHN1 from Nicotiana with 89% of identity |
---|---|
Blastx | Ras-related protein RHN1 from Nicotiana with 90.76% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420004.1) |
Pfam | ADP-ribosylation factor family (PF00025.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer