Protein coding transcript 38960

• Transcript: Ll_transcript_499671
• CDS coordinates: 2-571 (+)
• Peptide sequence: AVAVVVGSWVSPIGEAKLKSLALALEASNRPFLWVLRATWLPLLPTGFLERVFNQGIGIGIVVSWAPQIEILQHHSVGCYITHCGWNSTLEALQFQKRLLCYPVAGDQFLNCAYIVQVWRVGLKLNGLGHKDVEDGLARVMADKEMDNRLIQLSEKIMGMQDDDEKGSFMLKAFVEYLNKASSTSIHEN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_499671

• Blastp: UDP-glycosyltransferase 82A1 from Arabidopsis with 58.39% of identity
• Blastx: UDP-glycosyltransferase 82A1 from Arabidopsis with 57.67% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT3G22250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417788.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;