Protein coding transcript 3898

• Transcript: Ll_transcript_328808
• CDS coordinates: 2659-3144 (+)
• Peptide sequence: MQVRQHMSPPLSDGYYGTAITEGQVVLTMKELNEKPLSDIVKLVKESKNIAFTSYFIKNTIDTLESNPENFNVEEGPGATLALSDWKHLGFMPNVDFGWKEPINMVPAPCNMFEYEGLCIFLSPSNYDPSMEGGVRVFISLPSVAMPKFREEMEALKVTTS*
• ORF Type: complete

Annotations of Ll_transcript_328808

• Blastp: Spermidine sinapoyl-CoA acyltransferase from Arabidopsis with 38.22% of identity
• Blastx: Spermidine coumaroyl-CoA acyltransferase from Arabidopsis with 43.69% of identity
• Eggnog: BAHD family acyltransferase(ENOG410XNR7)
• Kegg: Link to kegg annotations (AT2G23510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417967.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;