Transcript | Ll_transcript_500050 |
---|---|
CDS coordinates | 1424-2341 (+) |
Peptide sequence | MCGLYKAMMEREEELAIKVFMFPCSADQPCKWLESLSIHQKGMWRRKCSCYSHCPFGLLPVKGGLQELWGRLDEFEYPHDSPFHNDYVSSPFLLSGWSEYYNLRSIPFASPVADILSHPLTVYHILTTLNISSKKLILKGKDVIVHYLGPEGELDWMSAFAEVSHLLNGLGNVHIVMVGPEVPTNLSDTTSGMGSRVRVNLVRGVYQVEASYLPTPHVVIALNSRLERYSSWGGALDLIKLMAVPAFFTDQSEASCLNAKQGLRNVGLHITQPVTPNPFRSPVKNLTPSCNLPSYSNGFVSGVNT* |
ORF Type | complete |
Blastp | Zinc finger MYND domain-containing protein 15 from Mus with 27.66% of identity |
---|---|
Blastx | Zinc finger MYND domain-containing protein 15 from Mus with 25.62% of identity |
Eggnog | zinc finger, MYND-type containing 15(ENOG4111I8B) |
Kegg | Link to kegg annotations (574428) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439800.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer