| Transcript | Ll_transcript_499812 |
|---|---|
| CDS coordinates | 576-926 (+) |
| Peptide sequence | MRCLMSILQLTEKMFRSLDNMTRNLRFTAPFPLLAYPVYLFSRSPGKTGSHFHPDSDLFGPNERNDIITSTLCWSAMVAILVGLSFVMGAGQVFMLYGVPYWVCFFSLFLLLVLLF* |
| ORF Type | complete |
| Blastp | Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 69.57% of identity |
|---|---|
| Blastx | Omega-3 fatty acid desaturase, chloroplastic from Soja with 64.43% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (105167042) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450336.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer