| Transcript | Ll_transcript_481953 |
|---|---|
| CDS coordinates | 2-367 (+) |
| Peptide sequence | MEQEAENGRLSRLNLAEKRERIAKMSLSDLSDYFHMPIGEAARRLDLCVTAVKKVCRSGDLERWPHRKIKSVVKQIRVLKRSLNSADAITRARTEADIIRLEELMKQHCGGIAPTAINYNP* |
| ORF Type | complete |
| Blastp | Protein RKD5 from Arabidopsis with 48.33% of identity |
|---|---|
| Blastx | Protein NLP2 from Oryza sativa with 34.74% of identity |
| Eggnog | RWP-RK domain-containing protein(ENOG410YJ4A) |
| Kegg | Link to kegg annotations (AT4G35590) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417127.1) |
| Pfam | RWP-RK domain (PF02042.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer