Protein coding transcript 39116

• Transcript: Ll_transcript_500062
• CDS coordinates: 143-970 (+)
• Peptide sequence: MEHRYAGPKSITILGQNSGVIDLTRNAWGYEVGLQGEKNKVFTEKGSKKVEWKDVKGKGHALSWYKTTFQTPEGRDPVAIKMHGMGKGMIWVNGLSIGRHWMSYLSPLGEPTQSDYHIPRAFLKEKENLLVILEEEEASPENIVIMRVNRDTICSIIRDNDPPNVRSWASKGMKLTPVVDKLMPEATLKCPNHKTIVAVEFASYGDPLGVCGAFTLGKCNAPITKQVVEQLCLGKEACTVPLEKSMLLKNGEDGCPGVVKELAIQVLCGTGASNQ*
• ORF Type: complete

Annotations of Ll_transcript_500062

• Blastp: Beta-galactosidase 11 from Arabidopsis with 54.35% of identity
• Blastx: Beta-galactosidase 11 from Arabidopsis with 53.72% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT4G35010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412879.1)
• Pfam: Beta-galactosidase jelly roll domain (PF13364.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;