Protein coding transcript 39157

• Transcript: Ll_transcript_500661
• CDS coordinates: 1000-1914 (+)
• Peptide sequence: MALKKGFSLVNINTWLVVLPQIIARIHSNNHAVRELIQSLLVRIGQNHPQALMYPLLVACKSISNLRKAAAQEVVDKVRQRSGVLVDQAQLVSKELIRVAILWHETWHEALEEASRLYFGEHNIEGMLKVLEPLHEMLEEGAMRNNVTIKERIFIEAYRQELLEAYECCVNYKRTGKDAELTQAWDIYYHVFRKIDKQLQSLTTLDLESVSPELLECRNLELAVPGTYRADAPVVTIASFARQLVVITSKQRPRKLTIHGSDGDDYAFLLKGHEDLRQDERVMQVFHLCWLCFKYTACISLVSS*
• ORF Type: complete

Annotations of Ll_transcript_500661

• Blastp: Serine/threonine-protein kinase TOR from Arabidopsis with 87.11% of identity
• Blastx: Serine/threonine-protein kinase TOR from Arabidopsis with 87.38% of identity
• Eggnog: phosphatidylinositol kinase activity(COG5032)
• Kegg: Link to kegg annotations (AT1G50030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423211.1)
• Pfam: FKBP12-rapamycin binding domain (PF08771.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;