Protein coding transcript 39169

• Transcript: Ll_transcript_500670
• CDS coordinates: 678-1025 (+)
• Peptide sequence: MRMKRTPGIHVLSAESKDLENAIRCGGLAPTKSSCIKNVLRLLVERRGKMCLEYLRDLSIDEIKAELSLFKGIGPKTVRFCYFLTDCFIICNDIIVFLICIASSLGICYCGMLLN*
• ORF Type: complete

Annotations of Ll_transcript_500670

• Blastp: Putative DNA glycosylase At3g47830 from Arabidopsis with 69.12% of identity
• Blastx: Putative DNA glycosylase At3g47830 from Arabidopsis with 64.89% of identity
• Eggnog: endonuclease III(COG0177)
• Kegg: Link to kegg annotations (AT3G47830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456600.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;