Transcript | Ll_transcript_500670 |
---|---|
CDS coordinates | 678-1025 (+) |
Peptide sequence | MRMKRTPGIHVLSAESKDLENAIRCGGLAPTKSSCIKNVLRLLVERRGKMCLEYLRDLSIDEIKAELSLFKGIGPKTVRFCYFLTDCFIICNDIIVFLICIASSLGICYCGMLLN* |
ORF Type | complete |
Blastp | Putative DNA glycosylase At3g47830 from Arabidopsis with 69.12% of identity |
---|---|
Blastx | Putative DNA glycosylase At3g47830 from Arabidopsis with 64.89% of identity |
Eggnog | endonuclease III(COG0177) |
Kegg | Link to kegg annotations (AT3G47830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456600.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer