Transcript | Ll_transcript_500646 |
---|---|
CDS coordinates | 114-542 (+) |
Peptide sequence | MSGEEGVVVPEPVAAASIPGEPMDILTALQLVLRKSLAYGGLARGLHEAAKVIEKHAAQLCVLAEDCDQPDYVKLVKALCAEHNVSLLTVPSAKTLGEWAGLCKIDSEGKARKVTGCSVVVVKDFGEEHEAYNVVLQHVKSN* |
ORF Type | complete |
Blastp | 40S ribosomal protein S12 from Hordeum with 73.43% of identity |
---|---|
Blastx | 40S ribosomal protein S12 from Hordeum with 79.2% of identity |
Eggnog | (ribosomal) protein(COG1358) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451829.1) |
Pfam | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer