Protein coding transcript 39177

• Transcript: Ll_transcript_501978
• CDS coordinates: 56-790 (+)
• Peptide sequence: MASLLNLVSLSPKTFSNTRTTTSSLQPRILQHPSSLSFNNSRWRFTVRAAETDANEAVKSQAPDKAPSKDGSSFNQLLGIKGAAQETNKWKIRLQLTKPVTWPPLVWGVVCGAAASGNFHWTFEDVAKSILCMMMSGPFLTGYTQTINDWYDREIDAINEPYRPIPSGAIAENEVITQIWVLLLGGLTIAGILDIWAGHDSPIVFYLALGGSLLSYIYSAPPLKLKQNGWIGNFALGASYISLP*
• ORF Type: complete

Annotations of Ll_transcript_501978

• Blastp: Chlorophyll synthase, chloroplastic from Arabidopsis with 75.89% of identity
• Blastx: Chlorophyll synthase, chloroplastic from Arabidopsis with 75.89% of identity
• Eggnog: Synthesis of 3-octaprenyl-4-hydroxybenzoate (By similarity)(COG0382)
• Kegg: Link to kegg annotations (AT3G51820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462285.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;