Protein coding transcript 39364

• Transcript: Ll_transcript_499819
• CDS coordinates: 891-2102 (+)
• Peptide sequence: MHQFLVGLVRLHLETVGHFGQMIATNAAIPGVFQNMFPLATSQVQPFSALPVMPVQAMTQQATRHARRVYVGGLSPTANEQSVATFFSQVMANIGGNTAGPGDAVVNVYINHDKKFAFVEMRSVEEASNAMALDGIIFEGAPVKVRRPTDYNPSLAATLGPSQPNPNLNLGAVGLTPGSAGGLDGPDRIFVGGLPYYFTETQIRELLETFGPLRGFDLVKDRETGNSKGYAFCVYQDLAVTDIACAALNGIKMGDKTLTVRRANQGSNLVQPKPEQESILMHAQQQIALQKLMLQPALVATKVVCLTHAVAADELKDDEDYEEILDDMRQECSKFGTLVNVVIPRPRPDGELAPGVGKVFLEYVDVDGATKARVGLNGRKFGGNQVIAVFYPENKFAQGDYEG*
• ORF Type: complete

Annotations of Ll_transcript_499819

• Blastp: Splicing factor U2af large subunit B from Nicotiana with 82.55% of identity
• Blastx: Splicing factor U2af large subunit B from Nicotiana with 82.55% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000929)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440705.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;