| Transcript | Ll_transcript_477398 |
|---|---|
| CDS coordinates | 77-466 (+) |
| Peptide sequence | MDSLHFMSLTLFFFIISVSSLRLPPFVDVNKTKHVPLVGFDPTRVTQLSWAPRAFLYKGFLSEKECDHVINMARGYLEKSLVAEGETGKNVMSNARTSSGMFLTKAEDEIIANIEARIATWTFLPYENGE |
| ORF Type | 3prime_partial |
| Blastp | Probable prolyl 4-hydroxylase 7 from Arabidopsis with 48.95% of identity |
|---|---|
| Blastx | Probable prolyl 4-hydroxylase 7 from Arabidopsis with 48.95% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT3G28480) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019419525.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer