Transcript | Ll_transcript_448715 |
---|---|
CDS coordinates | 1-390 (+) |
Peptide sequence | INPNIATIQTAHVLADEVYYLPVTPEYVTYVIEKERPDGIFLSFGGQTALNLGVQMNKMGIFDRYNVKVLGTSIRTLEVSEDRDLFAQALKEIDIPIAESIAVNTVDEALAAAETVGYPIIVRAAYALGG |
ORF Type | internal |
Blastp | Carbamoyl-phosphate synthase arginine-specific large chain from Schizosaccharomyces with 70.77% of identity |
---|---|
Blastx | Carbamoyl-phosphate synthase arginine-specific large chain from Schizosaccharomyces with 70.77% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC215.08c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004487142.1) |
Pfam | Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer