Protein coding transcript 397

• Transcript: Ll_transcript_448715
• CDS coordinates: 1-390 (+)
• Peptide sequence: INPNIATIQTAHVLADEVYYLPVTPEYVTYVIEKERPDGIFLSFGGQTALNLGVQMNKMGIFDRYNVKVLGTSIRTLEVSEDRDLFAQALKEIDIPIAESIAVNTVDEALAAAETVGYPIIVRAAYALGG
• ORF Type: internal

Annotations of Ll_transcript_448715

• Blastp: Carbamoyl-phosphate synthase arginine-specific large chain from Schizosaccharomyces with 70.77% of identity
• Blastx: Carbamoyl-phosphate synthase arginine-specific large chain from Schizosaccharomyces with 70.77% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC215.08c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004487142.1)
• Pfam: Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;