Protein coding transcript 39752

• Transcript: Ll_transcript_475553
• CDS coordinates: 271-783 (+)
• Peptide sequence: MSSCVKPLMQDKAANPVVLLHGFDSSCLEWRYTYPLLEEAGFEAWAIDILGWGFSDLGKLPSCDVVSKRDHLYQFWKSHIKRAMILVGPSLGSAVAIDFAINYPEAVEKLVLIDASVYAEGTGNLATLPKAVAYAGVSVLKSIPLRLYANYLTFNNISFSISLDWTNVSC*
• ORF Type: complete

Annotations of Ll_transcript_475553

• Blastp: Abhydrolase domain-containing protein cgi-58 from Caenorhabditis with 28.45% of identity
• Blastx: Abhydrolase domain-containing protein cgi-58 from Caenorhabditis with 28.93% of identity
• Eggnog: alpha/beta hydrolase fold(ENOG4112C3B)
• Kegg: Link to kegg annotations (CELE_C37H5.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445900.1)
• Pfam: alpha/beta hydrolase fold (PF00561.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;