Protein coding transcript 3992

• Transcript: Ll_transcript_453133
• CDS coordinates: 23-1006 (+)
• Peptide sequence: MGSNPDVVEDCMGFLKLFSDGSIYRSNNITFQASPIEDNTVVFKDCLFDKRFNLHLSLYNPQNQIKKKLPIVMFLHGGGFCFGSRTWPDIHNCCMRLATGLEAVVVAPDYRLAPEHRLPAAVDDGLEAVRWLQRKALSFKDSHNNGSVDDAWLNDVDFDRVFIVGDSSGGNIAHHVAVRLGSGSREMEPVRIRGYVLLAPFFGGVARTKSEEGPPEPILNLEILDRFWRLSMPIGESRDHPLANPFGPRSPNLGQLKLDPILVIVGGNELLKDRAEDYATRLKILGKDIEYIEFEGREHGFFTHNSYSEDAEDIIKILKRFMLENSA*
• ORF Type: complete

Annotations of Ll_transcript_453133

• Blastp: Probable carboxylesterase 15 from Arabidopsis with 56.27% of identity
• Blastx: Probable carboxylesterase 15 from Arabidopsis with 56.1% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (AT5G06570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424843.1)
• Pfam: Carboxylesterase family (PF00135.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;