Protein coding transcript 39976

• Transcript: Ll_transcript_476493
• CDS coordinates: 2-361 (+)
• Peptide sequence: VNWSFLLYMMERMSFCIRRKNWIKSCLQSNSVSILVNGSPTSEFSMCRGLRQGDLIAPFLFIIVAKGMAGLMMSVDSKKIYNCYPVGRDRVVVSHIQYADDTLLIGKNSTDNIVVLKGIL
• ORF Type: internal

Annotations of Ll_transcript_476493

• Blastp: Uncharacterized mitochondrial protein AtMg01250 from Arabidopsis with 31.88% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg01250 from Arabidopsis with 31.88% of identity
• Eggnog: Retrotransposon protein(ENOG410Y65V)
• Kegg: Link to kegg annotations (ArthMp102)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429814.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;