| Transcript | Ll_transcript_476496 |
|---|---|
| CDS coordinates | 151-474 (+) |
| Peptide sequence | MAIKKLFCGIGSILFRFLGIPIGANPRRISTWSHIIDCFKKKLSSWQQKLISFGGRVTLLQSILSSLPIYFFSFFKAPISVIHVLNKIHRRFLWGRGEVSKGINWVS* |
| ORF Type | complete |
| Blastp | Putative ribonuclease H protein At1g65750 from Arabidopsis with 36.36% of identity |
|---|---|
| Blastx | Putative ribonuclease H protein At1g65750 from Arabidopsis with 35.56% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418409.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer