Protein coding transcript 40029

• Transcript: Ll_transcript_476715
• CDS coordinates: 1755-2126 (+)
• Peptide sequence: MQKYDVKVMFLRNAFLVDTVTESIGRVLRLDSIETGDMWKGADILIFDSWHWWLHTGRKQPWDLIEDGSNRYRDMNRLVAYEKGLKTWSKWVDDNIDTNKTRVFFQGVSPDHLKYVHSPTYIE*
• ORF Type: complete

Annotations of Ll_transcript_476715

• Blastp: Protein trichome birefringence-like 43 from Arabidopsis with 62.39% of identity
• Blastx: Protein trichome birefringence-like 43 from Arabidopsis with 62.39% of identity
• Eggnog: Pfam:DUF231(ENOG4111BK6)
• Kegg: Link to kegg annotations (AT2G30900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459204.1)
• Pfam: GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p (PF13839.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;