Transcript | Ll_transcript_476711 |
---|---|
CDS coordinates | 331-879 (+) |
Peptide sequence | MLCSFQELNNLRPQLYSAAEYCQNSYLHTHQKQMVLDNLKDYAVRALVNVVDHLGTVAYKLTNLLEHQTLDVSTMDLKISTLNQKLHTCLIYTDKEGLRQQQLLAMIPRHHKHYILPNSANKKVHFNPKIQTDARQDQLQTRKHNQSSGIPVAKTLSWHLASETKSTLKKRAPRSTTKIKDQK |
ORF Type | 3prime_partial |
Blastp | Protein ABIL1 from Arabidopsis with 67.47% of identity |
---|---|
Blastx | Protein ABIL1 from Arabidopsis with 67.47% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT2G46225) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425182.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer