Protein coding transcript 40034

• Transcript: Ll_transcript_476723
• CDS coordinates: 137-439 (+)
• Peptide sequence: METSNTFILPLHELNNLRPQLYSAAEYCQNSYLHTHQKQMVLDNLKDYAVRALVNVVDHLGTVAYKLTNLLEHQTLDVSTMDLKISTLNQVIENIFEISR*
• ORF Type: complete

Annotations of Ll_transcript_476723

• Blastp: Probable protein ABIL1 from Oryza sativa with 70.65% of identity
• Blastx: Probable protein ABIL1 from Oryza sativa with 70.65% of identity
• Eggnog: cellular component movement(ENOG410Y0MH)
• Kegg: Link to kegg annotations (4326639)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425182.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;