Protein coding transcript 40149

• Transcript: Ll_transcript_475231
• CDS coordinates: 852-1268 (+)
• Peptide sequence: MTHSLTEHNTDDYVYDLYTVNDEMDMDADDTSYSLPLVQVDEDDYYDGPDDSEYETDDSNDENNPLNDYPDELSEDEEEGSESEDSNASKESSDEDNEEHGFSRDTEADPLYDEDFDNYDGRVGYDVDDDEDWKWSHR*
• ORF Type: complete

Annotations of Ll_transcript_475231

• Blastp: RNA-directed DNA methylation 4 from Arabidopsis with 49.21% of identity
• Blastx: RNA-directed DNA methylation 4 from Arabidopsis with 69.7% of identity
• Eggnog: NA(ENOG410ZJRU)
• Kegg: Link to kegg annotations (AT2G30280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438714.1)
• Pfam: Transcription factor Iwr1 (PF08574.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;