| Transcript | Ll_transcript_475233 |
|---|---|
| CDS coordinates | 1244-1660 (+) |
| Peptide sequence | MTHSLTEHNTDDYVYDLYTVNDEMDMDADDTSYSLPLVQVDEDDYYDGPDDSEYETDDSNDENNPLNDYPDELSEDEEEGSESEDSNASKESSDEDNEEHGFSRDTEADPLYDEDFDNYDGRVGYDVDDDEDWKWSHR* |
| ORF Type | complete |
| Blastp | RNA-directed DNA methylation 4 from Arabidopsis with 45.16% of identity |
|---|---|
| Blastx | RNA-directed DNA methylation 4 from Arabidopsis with 41.99% of identity |
| Eggnog | NA(ENOG410ZJRU) |
| Kegg | Link to kegg annotations (AT2G30280) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438714.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer