Transcript | Ll_transcript_475233 |
---|---|
CDS coordinates | 1244-1660 (+) |
Peptide sequence | MTHSLTEHNTDDYVYDLYTVNDEMDMDADDTSYSLPLVQVDEDDYYDGPDDSEYETDDSNDENNPLNDYPDELSEDEEEGSESEDSNASKESSDEDNEEHGFSRDTEADPLYDEDFDNYDGRVGYDVDDDEDWKWSHR* |
ORF Type | complete |
Blastp | RNA-directed DNA methylation 4 from Arabidopsis with 45.16% of identity |
---|---|
Blastx | RNA-directed DNA methylation 4 from Arabidopsis with 41.99% of identity |
Eggnog | NA(ENOG410ZJRU) |
Kegg | Link to kegg annotations (AT2G30280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438714.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer