Protein coding transcript 40153

• Transcript: Ll_transcript_475235
• CDS coordinates: 1145-1600 (+)
• Peptide sequence: MTHSLTEHNTDDYVYDLYTVNDEMDMDADDTSYSLPLVQVDEDDYYDGPDDSEYETDDSNDENNPLNDYPDELSEDEEEGSESEDSNASKESSDEDNEEHGFSRDTEADPLYDEDFDNYDGRVGYDVDDDEEGSESEDSNASKESSDEDNEE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_475235

• Blastp: RNA-directed DNA methylation 4 from Arabidopsis with 47.62% of identity
• Blastx: RNA-directed DNA methylation 4 from Arabidopsis with 47.29% of identity
• Eggnog: NA(ENOG410ZJRU)
• Kegg: Link to kegg annotations (AT2G30280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438714.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;