Protein coding transcript 40307

• Transcript: Ll_transcript_476004
• CDS coordinates: 541-837 (+)
• Peptide sequence: MKYFVVWLQHIELISPAPANAEVANFDVFGPVCESADFLGKDRQLPTPDKGTGLVVHDAGAYCMSMASTYNLKMRPPEYWVEDNGTVSKIRHGETFEDH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_476004

• Blastp: Diaminopimelate decarboxylase 1, chloroplastic from Arabidopsis with 81.32% of identity
• Blastx: Diaminopimelate decarboxylase 1, chloroplastic from Arabidopsis with 81.32% of identity
• Eggnog: Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine (By similarity)(COG0019)
• Kegg: Link to kegg annotations (AT3G14390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431286.1)
• Pfam: Pyridoxal-dependent decarboxylase, C-terminal sheet domain (PF00278.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;