Protein coding transcript 4031

• Transcript: Ll_transcript_453136
• CDS coordinates: 1816-2619 (+)
• Peptide sequence: MQVITRINYGQSVHMSGLAGAVSLAGSGGGLWSIEGGNWQMAAGLINRSDVVLHLNEEIKSVAHIGDYYELNSSKGNSYTCEVAVVATPLDELNTQFNPPISIPERKLQHTYTTFVRGLLDPVYFGLNVESKVPELVGTIEDPDLPFSSISVLKKHSEKESTYKIFSRQPMADTLLDSIFSARKETIRINWAAYPHYHAPEIFAPFILDEQHLYYVNAFENAASTMETSCVAAENIARLILSRYFGKEIVQSSQTPGSQGEGEHSDL*
• ORF Type: complete

Annotations of Ll_transcript_453136

• Blastp: Farnesylcysteine lyase from Arabidopsis with 71.77% of identity
• Blastx: Farnesylcysteine lyase from Arabidopsis with 70.87% of identity
• Eggnog: Prenylcysteine oxidase 1(ENOG410Y3UN)
• Kegg: Link to kegg annotations (AT5G63910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432084.1)
• Pfam: Prenylcysteine lyase (PF07156.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;