Protein coding transcript 4032

• Transcript: Ll_transcript_453137
• CDS coordinates: 1816-2361 (+)
• Peptide sequence: MQVITRINYGQSVHMSGLAGAVSLAGSGGGLWSIEGGNWQMAAGLINRSDVVLHLNEEIKSVAHIGDYYELNSSKGNSYTCEVAVVATPLDELNTQFNPPISIPERKLQHTYTTFVRGLLDPVYFGLNVESKVPELVGTIEDPDLPFSSISVLKKHSEKESTYKIFSRQPMADTLLDSIFR*
• ORF Type: complete

Annotations of Ll_transcript_453137

• Blastp: Farnesylcysteine lyase from Arabidopsis with 69.44% of identity
• Blastx: Farnesylcysteine lyase from Arabidopsis with 68.28% of identity
• Eggnog: Prenylcysteine oxidase 1(ENOG410Y3UN)
• Kegg: Link to kegg annotations (AT5G63910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432084.1)
• Pfam: Prenylcysteine lyase (PF07156.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;