Protein coding transcript 40372

• Transcript: Ll_transcript_475471
• CDS coordinates: 154-612 (+)
• Peptide sequence: MAPPMKIIFGLLTLVTVGMIIGALSQLAFIRKLEDSYDTDSRPFRRLRELGSNGYIQLPRGLNFWNNDEEAKILRLGYIKPEVLSWSPRIILLHNFLSIEECDYLRAIALPRLKNSTVVDKATGKSIKSGVRTSNGMFLSRKERKYPMVEVS*
• ORF Type: complete

Annotations of Ll_transcript_475471

• Blastp: Prolyl 4-hydroxylase 1 from Arabidopsis with 60.93% of identity
• Blastx: Prolyl 4-hydroxylase 1 from Arabidopsis with 79.1% of identity
• Eggnog: prolyl 4-hydroxylase(ENOG410XS5J)
• Kegg: Link to kegg annotations (AT2G43080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441584.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;