Protein coding transcript 40373

• Transcript: Ll_transcript_475475
• CDS coordinates: 536-991 (+)
• Peptide sequence: MFLSRKERKYPMVEAIEKRISVYAQIPIENGELIHVLRYQKNQFYKPHFDYFSDNFNLKRGGQRIATMLMYLTDNVDGGETYFPTAGSGHCSCGGEIVQGLCVKPTKGNAVLFWSMGLDGQSDPNSLHGSCEVLSGEKWSATKWMRQAFHT*
• ORF Type: complete

Annotations of Ll_transcript_475475

• Blastp: Prolyl 4-hydroxylase 1 from Arabidopsis with 76.19% of identity
• Blastx: Prolyl 4-hydroxylase 1 from Arabidopsis with 73.52% of identity
• Eggnog: prolyl 4-hydroxylase(ENOG410XS5J)
• Kegg: Link to kegg annotations (AT2G43080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441584.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF13640.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;