Transcript | Ll_transcript_453166 |
---|---|
CDS coordinates | 279-725 (+) |
Peptide sequence | MVLQRSMVQRVVEGITFLFELLVKFVLSVQKVDPHPENKDDGYGLSWRLAVETNNVRGWKTVPPKCYKHVEEYMTGGQYEVDLKLIVDQILGYASQISVSSDGFDAWILDVDDTCISNISYYKAMRFGSVFLCGYAFYTIMLIYMSRR* |
ORF Type | complete |
Blastp | Acid phosphatase 1 from Lycopersicon with 34.68% of identity |
---|---|
Blastx | Acid phosphatase 1 from Lycopersicon with 34.68% of identity |
Eggnog | Acid phosphatase(ENOG410YBHH) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430442.1) |
Pfam | HAD superfamily, subfamily IIIB (Acid phosphatase) (PF03767.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer